Binds melanocortin-2 receptor (MC2R) on adrenal cortex, stimulating cortisol synthesis.
Reference facts
- Also known as
- Adrenocorticotropic Hormone, Acthar Gel
- Category
- Hormonal & Pituitary
- Mechanism of action
- Binds melanocortin-2 receptor (MC2R) on adrenal cortex, stimulating cortisol synthesis.
- Targets
- MC2R
- Indications under research or approved
- Infantile spasms (West syndrome), Multiple sclerosis exacerbations, Diagnostic testing
- Regulatory status (reference entry)
- FDA-approved (Acthar Gel)
- Half-life
- ~15 minutes
- Sequence
- SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
- Sequence notes
- 39-residue peptide hormone produced by anterior pituitary corticotrophs.
- Molecular weight (Da)
- 4541
- First reported
- 1955
Primary References
Explore research articles about ACTH (Corticotropin)
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.