Albumin-fused GLP-1 receptor agonist for once-weekly dosing.
Reference facts
- Also known as
- Tanzeum, Eperzan
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Albumin-fused GLP-1 receptor agonist for once-weekly dosing.
- Targets
- GLP-1R
- Indications under research or approved
- Type 2 Diabetes (discontinued)
- Regulatory status (reference entry)
- Withdrawn 2018 (commercial reasons)
- Half-life
- ~5 days
- Sequence
- HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- Sequence notes
- Two GLP-1(7-36) tandem peptides with Gly8 substitution genetically fused to recombinant human albumin (~73 kDa).
- Molecular weight (Da)
- 73000
- Originator / sponsor
- GlaxoSmithKline
- First reported
- 2009
Primary References
Explore research articles about Albiglutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.