Activates NPR-A, elevating cGMP. Vasodilation, natriuresis, suppression of RAAS.
Reference facts
- Also known as
- Nesiritide, Natrecor
- Category
- Cardiovascular & Natriuretic
- Mechanism of action
- Activates NPR-A, elevating cGMP. Vasodilation, natriuresis, suppression of RAAS.
- Targets
- NPR-A
- Indications under research or approved
- Acute decompensated heart failure (Nesiritide; withdrawn 2018 in US for commercial reasons after ASCEND-HF efficacy concerns)
- Regulatory status (reference entry)
- Withdrawn in US (2018)
- Half-life
- ~20 minutes (recombinant Nesiritide)
- Sequence
- SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Sequence notes
- 32-residue peptide with disulfide bridge Cys10-Cys26.
- Molecular weight (Da)
- 3464
- First reported
- 1988
Primary References
Explore research articles about B-type Natriuretic Peptide (BNP)
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.