Inhibits osteoclast bone resorption; mild analgesic effect on bone pain.
Reference facts
- Also known as
- Miacalcin, Fortical, Salcatonin
- Category
- Bone & Calcium
- Mechanism of action
- Inhibits osteoclast bone resorption; mild analgesic effect on bone pain.
- Targets
- Calcitonin receptor
- Indications under research or approved
- Osteoporosis (post-menopausal, ≥5y post), Paget's disease of bone, Hypercalcemia of malignancy
- Regulatory status (reference entry)
- FDA-approved (1986; FDA 2013 advisory restricted use due to malignancy signal)
- Half-life
- ~20 minutes (subcutaneous); shorter intranasal
- Sequence
- CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
- Sequence notes
- 32-residue peptide with disulfide bridge Cys1-Cys7 and C-terminal amide. Salmon calcitonin is ~50× more potent than human calcitonin in humans.
- Molecular weight (Da)
- 3432
- PDB accession
- 2GLH
- First reported
- 1962
Primary References
Explore research articles about Calcitonin (Salmon)
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.