Once-daily dual GLP-1 / glucagon receptor agonist.
Reference facts
- Also known as
- MEDI0382
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Once-daily dual GLP-1 / glucagon receptor agonist.
- Targets
- GLP-1R, GCGR
- Indications under research or approved
- Type 2 Diabetes, MASH (development paused)
- Regulatory status (reference entry)
- Investigational (Phase 2 paused 2023)
- Half-life
- ~12 hours
- Sequence
- HSQGTFTSDYSKYLDEEAVRLFIEWLKNGGPSSGAPPPS
- Sequence notes
- Dual GLP-1 / glucagon agonist with palmitic acid attachment.
- Molecular weight (Da)
- 4300
- Originator / sponsor
- AstraZeneca / MedImmune
- First reported
- 2018
Primary References
Explore research articles about Cotadutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.