Once-weekly GLP-1 receptor agonist. Half-life extension via FcRn recycling.
Reference facts
- Also known as
- Trulicity
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Once-weekly GLP-1 receptor agonist. Half-life extension via FcRn recycling.
- Targets
- GLP-1R
- Indications under research or approved
- Type 2 Diabetes, Cardiovascular Risk Reduction
- Regulatory status (reference entry)
- FDA-approved (2014)
- Half-life
- ~120 hours (~5 days)
- Sequence
- HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
- Sequence notes
- Two GLP-1(7-37) analog peptides with Gly8/Glu22/Gly36 substitutions, linked via flexible peptide spacers to a human IgG4 Fc fragment.
- Molecular weight (Da)
- 59670
- Originator / sponsor
- Eli Lilly
- First reported
- 2010
- Origin
- Engineered as an Fc-fusion to provide weekly dosing without fatty-acid acylation.
Primary References
Explore research articles about Dulaglutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.