Once-weekly dual GLP-1 / glucagon receptor agonist optimized for liver fat reduction.
Reference facts
- Also known as
- MK-6024, JNJ-64565111, HM12525A
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Once-weekly dual GLP-1 / glucagon receptor agonist optimized for liver fat reduction.
- Targets
- GLP-1R, GCGR
- Indications under research or approved
- MASH, Obesity
- Regulatory status (reference entry)
- Investigational (Phase 2)
- Half-life
- ~6–8 days
- Sequence
- HSQGTFTSDYSKYLDEKAAKEFIEWLLEGGPSSGAPPPS
- Sequence notes
- Dual GLP-1 / glucagon agonist on Hanmi's LAPSCOVERY half-life extension platform (PEGylated Fc-like carrier).
- Molecular weight (Da)
- 60000
- Originator / sponsor
- Merck (license from Hanmi)
- First reported
- 2018
Primary References
Explore research articles about Efinopegdutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.