GLP-1 receptor agonist resistant to DPP-4 cleavage thanks to Gly substitution at position 2.
Reference facts
- Also known as
- Byetta, Bydureon, Exendin-4
- Category
- GLP-1 & Metabolic
- Mechanism of action
- GLP-1 receptor agonist resistant to DPP-4 cleavage thanks to Gly substitution at position 2.
- Targets
- GLP-1R
- Indications under research or approved
- Type 2 Diabetes
- Regulatory status (reference entry)
- FDA-approved (Byetta 2005, Bydureon 2012)
- Half-life
- ~2.4 hours (Byetta) / ~2 weeks (Bydureon LAR microsphere)
- Sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- Sequence notes
- 39-residue peptide derived from exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum).
- Molecular weight (Da)
- 4187
- PDB accession
- 1JRJ
- Originator / sponsor
- Amylin / AstraZeneca
- First reported
- 1992
- Origin
- Discovered by John Eng in Gila monster venom; first peptide isolated from a non-mammalian source to become an FDA-approved drug.
Primary References
Explore research articles about Exenatide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.