Disrupts the FOXO4-p53 interaction in senescent cells, freeing p53 to trigger intrinsic apoptosis selectively in senescent cells (senolytic).
Reference facts
- Also known as
- FOXO4-D-Retro-Inverso, ProxofimTM (research)
- Category
- Mitochondrial & Cellular Longevity
- Mechanism of action
- Disrupts the FOXO4-p53 interaction in senescent cells, freeing p53 to trigger intrinsic apoptosis selectively in senescent cells (senolytic).
- Targets
- FOXO4-p53 complex
- Indications under research or approved
- Research — senescent cell clearance, age-related disease
- Regulatory status (reference entry)
- Preclinical / research only
- Half-life
- Hours (DRI form resists proteolysis)
- Sequence
- LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
- Sequence notes
- D-retro-inverso (DRI) peptide derived from the FOXO4 / p53 interaction interface, fused to a HIV-Tat-derived cell-penetrating sequence.
- Molecular weight (Da)
- 5305
- First reported
- 2017
- Origin
- Designed by de Keizer lab; published in Cell 2017.
Primary References
Explore research articles about FOXO4-DRI
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.