Once-daily GLP-1 receptor agonist. Albumin binding via fatty acid extends in-vivo half-life.
Reference facts
- Also known as
- Victoza, Saxenda
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Once-daily GLP-1 receptor agonist. Albumin binding via fatty acid extends in-vivo half-life.
- Targets
- GLP-1R
- Indications under research or approved
- Type 2 Diabetes (Victoza), Chronic Weight Management (Saxenda)
- Regulatory status (reference entry)
- FDA-approved (Victoza 2010, Saxenda 2014)
- Half-life
- ~13 hours
- Sequence
- HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
- Sequence notes
- 31-residue GLP-1(7-37) analog with Lys26 acylated by a γ-glutamyl-spaced C16 palmitic acid (mediates albumin binding).
- Molecular weight (Da)
- 3751
- PDB accession
- 4APD
- Originator / sponsor
- Novo Nordisk
- First reported
- 2000
- Origin
- First once-daily GLP-1 analog, scaffold for the entire fatty-acid acylation strategy used by Semaglutide and Tirzepatide.
Primary References
Explore research articles about Liraglutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.