Short-acting GLP-1 receptor agonist with strong post-prandial glucose effect.
Reference facts
- Also known as
- Adlyxin, Lyxumia
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Short-acting GLP-1 receptor agonist with strong post-prandial glucose effect.
- Targets
- GLP-1R
- Indications under research or approved
- Type 2 Diabetes
- Regulatory status (reference entry)
- FDA-approved (2016, US discontinued 2023)
- Half-life
- ~3 hours
- Sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
- Sequence notes
- Exendin-4 analog with C-terminal six-lysine tail and Pro38 deletion.
- Molecular weight (Da)
- 4858
- Originator / sponsor
- Sanofi
- First reported
- 2007
Primary References
Explore research articles about Lixisenatide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.