Cationic alpha-helix that disrupts microbial membranes and modulates innate immunity (chemotaxis, angiogenesis, wound healing).
Reference facts
- Also known as
- Cathelicidin, hCAP18 (37 aa fragment)
- Category
- Immune Modulator
- Mechanism of action
- Cationic alpha-helix that disrupts microbial membranes and modulates innate immunity (chemotaxis, angiogenesis, wound healing).
- Targets
- Microbial membranes, FPR2/ALX receptor
- Indications under research or approved
- Research — antibiotic-resistant infections, wound healing, vitamin D innate immunity
- Regulatory status (reference entry)
- Not FDA-approved
- Half-life
- Minutes (rapidly degraded)
- Sequence
- [LL-37, 37 aa]
- Sequence notes
- 37-residue active fragment of human cathelicidin antimicrobial peptide hCAP18; cleaved from the proform by proteinase 3.
- Molecular weight (Da)
- 4493
- PDB accession
- 2K6O
- First reported
- 1995
Primary References
Explore research articles about LL-37
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.