Dual GLP-1 / glucagon receptor agonist licensed from Eli Lilly's OXM3 program.
Reference facts
- Also known as
- IBI362, OXM3
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Dual GLP-1 / glucagon receptor agonist licensed from Eli Lilly's OXM3 program.
- Targets
- GLP-1R, GCGR
- Indications under research or approved
- Obesity, Type 2 Diabetes, MASH
- Regulatory status (reference entry)
- Approved in China (2025); Phase 3 in other regions
- Half-life
- ~140 hours (~6 days)
- Sequence
- HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
- Sequence notes
- Oxyntomodulin analog with dual GLP-1 / glucagon activity; C18 fatty acid linker.
- Molecular weight (Da)
- 4400
- Originator / sponsor
- Innovent Biologics (China license from Eli Lilly)
- First reported
- 2020
Primary References
Explore research articles about Mazdutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.