Native dual incretin/glucagon hormone — template for synthetic dual agonists like Cotadutide and Mazdutide.
Reference facts
- Also known as
- OXM
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Native dual incretin/glucagon hormone — template for synthetic dual agonists like Cotadutide and Mazdutide.
- Targets
- GLP-1R, GCGR
- Indications under research or approved
- Obesity (research)
- Regulatory status (reference entry)
- Investigational
- Half-life
- ~12 minutes
- Sequence
- HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
- Sequence notes
- 37-residue native dual GLP-1 / glucagon receptor agonist; proglucagon-derived gut hormone.
- Molecular weight (Da)
- 4448
- First reported
- 1983
Primary References
Explore research articles about Oxyntomodulin
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.