Balanced 1:1 GLP-1 / glucagon agonism designed to combine satiety with hepatic lipid burning.
Reference facts
- Also known as
- ALT-801
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Balanced 1:1 GLP-1 / glucagon agonism designed to combine satiety with hepatic lipid burning.
- Targets
- GLP-1R, GCGR
- Indications under research or approved
- Obesity, MASH
- Regulatory status (reference entry)
- Investigational (Phase 2)
- Half-life
- ~6 days
- Sequence
- HSQGTFTSDYSKYLDEKAAKEFVNWLLAGGPSSGAPPPS
- Sequence notes
- Dual GLP-1 / glucagon receptor agonist with proprietary C18 lipid moiety (EuPort technology).
- Molecular weight (Da)
- 4500
- Originator / sponsor
- Altimmune
- First reported
- 2021
Primary References
Explore research articles about Pemvidutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.