Selective Y2 receptor agonist in the arcuate nucleus, suppressing appetite via NPY neuron inhibition.
Reference facts
- Also known as
- Peptide YY (3-36)
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Selective Y2 receptor agonist in the arcuate nucleus, suppressing appetite via NPY neuron inhibition.
- Targets
- Y2 receptor
- Indications under research or approved
- Obesity (research; native peptide and long-acting analogs)
- Regulatory status (reference entry)
- Investigational
- Half-life
- ~10 minutes (native); analogs extend to days
- Sequence
- IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
- Sequence notes
- 34-residue gut-derived satiety peptide; a DPP-4 cleavage product of PYY 1-36.
- Molecular weight (Da)
- 4050
- PDB accession
- 2DEZ
- Originator / sponsor
- Novo Nordisk and others (analogs)
- First reported
- 1982
Primary References
Explore research articles about PYY 3-36
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.