Triple agonist of GLP-1, GIP and glucagon receptors. Glucagon arm increases energy expenditure on top of incretin-driven satiety and insulinotropic effects.
Reference facts
- Also known as
- LY3437943
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Triple agonist of GLP-1, GIP and glucagon receptors. Glucagon arm increases energy expenditure on top of incretin-driven satiety and insulinotropic effects.
- Targets
- GLP-1R, GIPR, GCGR
- Indications under research or approved
- Obesity, Type 2 Diabetes, MASH
- Regulatory status (reference entry)
- Investigational (Phase 3 — TRIUMPH program)
- Half-life
- ~124 hours (~5–6 days)
- Sequence
- YXEGTFTSDYSIYLDKKAQEAFVNWLLAGGPSSGAPPPS
- Sequence notes
- Triple agonist (GLP-1 / GIP / glucagon) with two C20 fatty diacid linkers and Aib substitutions at positions 2 and 13 (X = α-Aminoisobutyric acid). Representative backbone shown.
- Molecular weight (Da)
- 4731
- Originator / sponsor
- Eli Lilly
- First reported
- 2022
- Origin
- Disclosed at the 2022 ADA Scientific Sessions; first-in-human data published NEJM 2023.
Primary References
- Jastreboff et al., NEJM 2023 (Retatrutide Phase 2 obesity)
- Rosenstock et al., Lancet 2023 (Retatrutide Phase 2 T2D)
- TRIUMPH-1 (NCT05882045)
Explore research articles about Retatrutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.