Dual GLP-1 / glucagon receptor agonist. Glucagon arm drives hepatic lipid mobilization and energy expenditure.
Reference facts
- Also known as
- BI 456906
- Category
- GLP-1 & Metabolic
- Mechanism of action
- Dual GLP-1 / glucagon receptor agonist. Glucagon arm drives hepatic lipid mobilization and energy expenditure.
- Targets
- GLP-1R, GCGR
- Indications under research or approved
- Obesity, MASH
- Regulatory status (reference entry)
- Investigational (Phase 3 SYNCHRONIZE; FDA Breakthrough Therapy for MASH 2024)
- Half-life
- ~5 days
- Sequence
- HSQGTFTSDYSKYLDEKAAKEFIEWLLEGGPSSGAPPPS
- Sequence notes
- Dual GLP-1 / glucagon receptor agonist with C18 fatty acid moiety and Aib stabilization.
- Molecular weight (Da)
- 4500
- Originator / sponsor
- Boehringer Ringer / Zealand Pharma
- First reported
- 2022
Primary References
Explore research articles about Survodutide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.