Intermittent PTH receptor activation paradoxically stimulates osteoblastic bone formation more than osteoclastic resorption.
Reference facts
- Also known as
- Forteo, PTH 1-34, rhPTH(1-34)
- Category
- Bone & Calcium
- Mechanism of action
- Intermittent PTH receptor activation paradoxically stimulates osteoblastic bone formation more than osteoclastic resorption.
- Targets
- PTH1R
- Indications under research or approved
- Severe osteoporosis (post-menopausal women, men, glucocorticoid-induced)
- Regulatory status (reference entry)
- FDA-approved (2002)
- Half-life
- ~1 hour
- Sequence
- SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
- Sequence notes
- 34-residue N-terminal active fragment of human parathyroid hormone, recombinant.
- Molecular weight (Da)
- 4118
- PDB accession
- 1ET1
- Originator / sponsor
- Eli Lilly
- First reported
- 1995
Primary References
Explore research articles about Teriparatide
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.