Stabilized full-length GHRH analog. Lipid modification protects against DPP-4 cleavage.
Reference facts
- Also known as
- Egrifta, TH9507
- Category
- Growth Hormone & Ghrelin
- Mechanism of action
- Stabilized full-length GHRH analog. Lipid modification protects against DPP-4 cleavage.
- Targets
- GHRHR
- Indications under research or approved
- HIV-associated lipodystrophy (visceral adipose reduction)
- Regulatory status (reference entry)
- FDA-approved (2010)
- Half-life
- ~26 minutes (subcutaneous)
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Sequence notes
- 44-residue full-length human GHRH (1-44) NH2 with a trans-3-hexenoyl group attached to the N-terminal tyrosine.
- Molecular weight (Da)
- 5135
- Originator / sponsor
- Theratechnologies
- First reported
- 2007
Primary References
Explore research articles about Tesamorelin
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.