Sequesters G-actin (1:1 stoichiometry), regulating cytoskeletal dynamics; promotes endothelial cell migration, angiogenesis, anti-inflammation.
Reference facts
- Also known as
- TB-4, Tβ4
- Category
- Healing & Tissue Repair
- Mechanism of action
- Sequesters G-actin (1:1 stoichiometry), regulating cytoskeletal dynamics; promotes endothelial cell migration, angiogenesis, anti-inflammation.
- Targets
- G-actin, Multiple cytokine pathways
- Indications under research or approved
- Dry eye disease (RGN-259 Phase 3), Cardiac repair, wound healing (clinical trials)
- Regulatory status (reference entry)
- Investigational
- Half-life
- ~12 hours
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Sequence notes
- 43-residue ubiquitous actin-sequestering peptide; N-terminal acetylated in vivo.
- Molecular weight (Da)
- 4963
- PDB accession
- 1HJ0
- Originator / sponsor
- RegeneRx Biopharmaceuticals (RGN-259)
- First reported
- 1981
Primary References
Explore research articles about Thymosin Beta-4
This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.