ACTH (Corticotropin) Research: What 67,598 Studies Show (2026) | RetatrutideCompare

ACTH (Corticotropin) — 67,598 studies indexed on PubMed. Binds melanocortin-2 receptor (MC2R) on adrenal cortex, stimulating cortisol synthesis. Half-life: ~15 minutes. FDA status: FDA-approved (Acthar Gel).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on ACTH (Corticotropin)?

There are approximately 67,598 studies indexed on PubMed that mention ACTH (Corticotropin) (Adrenocorticotropic Hormone, Acthar Gel), based on a search last updated 2026-06-18.

Is ACTH (Corticotropin) FDA-approved?

FDA status: FDA-approved (Acthar Gel).

How does ACTH (Corticotropin) work?

Binds melanocortin-2 receptor (MC2R) on adrenal cortex, stimulating cortisol synthesis.

Reference facts

Also known as: Adrenocorticotropic Hormone, Acthar Gel
Category: Hormonal & Pituitary
Mechanism of action: Binds melanocortin-2 receptor (MC2R) on adrenal cortex, stimulating cortisol synthesis.
Targets: MC2R
Indications under research or approved: Infantile spasms (West syndrome), Multiple sclerosis exacerbations, Diagnostic testing
Regulatory status (reference entry): FDA-approved (Acthar Gel)
Half-life: ~15 minutes
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence notes: 39-residue peptide hormone produced by anterior pituitary corticotrophs.
Molecular weight (Da): 4541
First reported: 1955

Primary References

Acthar Gel FDA label

Explore research articles about ACTH (Corticotropin)

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.