Albiglutide Research: What 288 Studies Show (2026) | RetatrutideCompare

Albiglutide — 288 studies indexed on PubMed. Albumin-fused GLP-1 receptor agonist for once-weekly dosing. Half-life: ~5 days. FDA status: Withdrawn 2018 (commercial reasons).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Albiglutide?

There are approximately 288 studies indexed on PubMed that mention Albiglutide (Tanzeum, Eperzan), based on a search last updated 2026-06-18.

Is Albiglutide FDA-approved?

FDA status: Withdrawn 2018 (commercial reasons).

How does Albiglutide work?

Albumin-fused GLP-1 receptor agonist for once-weekly dosing.

Albumin-fused GLP-1 receptor agonist for once-weekly dosing.

Reference facts

Also known as
Tanzeum, Eperzan
Category
GLP-1 & Metabolic
Mechanism of action
Albumin-fused GLP-1 receptor agonist for once-weekly dosing.
Targets
GLP-1R
Indications under research or approved
Type 2 Diabetes (discontinued)
Regulatory status (reference entry)
Withdrawn 2018 (commercial reasons)
Half-life
~5 days
Sequence
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence notes
Two GLP-1(7-36) tandem peptides with Gly8 substitution genetically fused to recombinant human albumin (~73 kDa).
Molecular weight (Da)
73000
Originator / sponsor
GlaxoSmithKline
First reported
2009

Primary References

Explore research articles about Albiglutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.