Calcitonin (Salmon) Research: What 38,385 Studies Show (2026) | RetatrutideCompare

Calcitonin (Salmon) — 38,385 studies indexed on PubMed. Inhibits osteoclast bone resorption; mild analgesic effect on bone pain. Half-life: ~20 minutes (subcutaneous); shorter intranasal. FDA status: FDA-approved (1986; FDA 2013 advisory restricted use due to malignancy signal).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Calcitonin (Salmon)?

There are approximately 38,385 studies indexed on PubMed that mention Calcitonin (Salmon) (Miacalcin, Fortical), based on a search last updated 2026-06-18.

Is Calcitonin (Salmon) FDA-approved?

FDA status: FDA-approved (1986; FDA 2013 advisory restricted use due to malignancy signal).

How does Calcitonin (Salmon) work?

Inhibits osteoclast bone resorption; mild analgesic effect on bone pain.

Reference facts

Also known as: Miacalcin, Fortical, Salcatonin
Category: Bone & Calcium
Mechanism of action: Inhibits osteoclast bone resorption; mild analgesic effect on bone pain.
Targets: Calcitonin receptor
Indications under research or approved: Osteoporosis (post-menopausal, ≥5y post), Paget's disease of bone, Hypercalcemia of malignancy
Regulatory status (reference entry): FDA-approved (1986; FDA 2013 advisory restricted use due to malignancy signal)
Half-life: ~20 minutes (subcutaneous); shorter intranasal
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Sequence notes: 32-residue peptide with disulfide bridge Cys1-Cys7 and C-terminal amide. Salmon calcitonin is ~50× more potent than human calcitonin in humans.
Molecular weight (Da): 3432
PDB accession: 2GLH
First reported: 1962

Primary References

Miacalcin FDA label

Explore research articles about Calcitonin (Salmon)

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.