Cotadutide Research: What 61 Studies Show (2026) | RetatrutideCompare

Cotadutide — 61 studies indexed on PubMed. Once-daily dual GLP-1 / glucagon receptor agonist. Half-life: ~12 hours. FDA status: Investigational (Phase 2 paused 2023).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Cotadutide?

There are approximately 61 studies indexed on PubMed that mention Cotadutide (MEDI0382), based on a search last updated 2026-06-18.

Is Cotadutide FDA-approved?

FDA status: Investigational (Phase 2 paused 2023).

How does Cotadutide work?

Once-daily dual GLP-1 / glucagon receptor agonist.

Once-daily dual GLP-1 / glucagon receptor agonist.

Reference facts

Also known as
MEDI0382
Category
GLP-1 & Metabolic
Mechanism of action
Once-daily dual GLP-1 / glucagon receptor agonist.
Targets
GLP-1R, GCGR
Indications under research or approved
Type 2 Diabetes, MASH (development paused)
Regulatory status (reference entry)
Investigational (Phase 2 paused 2023)
Half-life
~12 hours
Sequence
HSQGTFTSDYSKYLDEEAVRLFIEWLKNGGPSSGAPPPS
Sequence notes
Dual GLP-1 / glucagon agonist with palmitic acid attachment.
Molecular weight (Da)
4300
Originator / sponsor
AstraZeneca / MedImmune
First reported
2018

Primary References

Explore research articles about Cotadutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.