Dulaglutide Research: What 1,266 Studies Show (2026) | RetatrutideCompare

Dulaglutide — 1,266 studies indexed on PubMed. Once-weekly GLP-1 receptor agonist. Half-life extension via FcRn recycling. Half-life: ~120 hours (~5 days). FDA status: FDA-approved (2014).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Dulaglutide?

There are approximately 1,266 studies indexed on PubMed that mention Dulaglutide (Trulicity), based on a search last updated 2026-06-18.

Is Dulaglutide FDA-approved?

FDA status: FDA-approved (2014).

How does Dulaglutide work?

Once-weekly GLP-1 receptor agonist. Half-life extension via FcRn recycling.

Once-weekly GLP-1 receptor agonist. Half-life extension via FcRn recycling.

Reference facts

Also known as
Trulicity
Category
GLP-1 & Metabolic
Mechanism of action
Once-weekly GLP-1 receptor agonist. Half-life extension via FcRn recycling.
Targets
GLP-1R
Indications under research or approved
Type 2 Diabetes, Cardiovascular Risk Reduction
Regulatory status (reference entry)
FDA-approved (2014)
Half-life
~120 hours (~5 days)
Sequence
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
Sequence notes
Two GLP-1(7-37) analog peptides with Gly8/Glu22/Gly36 substitutions, linked via flexible peptide spacers to a human IgG4 Fc fragment.
Molecular weight (Da)
59670
Originator / sponsor
Eli Lilly
First reported
2010
Origin
Engineered as an Fc-fusion to provide weekly dosing without fatty-acid acylation.

Primary References

Explore research articles about Dulaglutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.