Efinopegdutide Research: What 10 Studies Show (2026) | RetatrutideCompare

Efinopegdutide — 10 studies indexed on PubMed. Once-weekly dual GLP-1 / glucagon receptor agonist optimized for liver fat reduction. Half-life: ~6–8 days. FDA status: Investigational (Phase 2).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Efinopegdutide?

There are approximately 10 studies indexed on PubMed that mention Efinopegdutide (MK-6024, JNJ-64565111), based on a search last updated 2026-06-18.

Is Efinopegdutide FDA-approved?

FDA status: Investigational (Phase 2).

How does Efinopegdutide work?

Once-weekly dual GLP-1 / glucagon receptor agonist optimized for liver fat reduction.

Once-weekly dual GLP-1 / glucagon receptor agonist optimized for liver fat reduction.

Reference facts

Also known as
MK-6024, JNJ-64565111, HM12525A
Category
GLP-1 & Metabolic
Mechanism of action
Once-weekly dual GLP-1 / glucagon receptor agonist optimized for liver fat reduction.
Targets
GLP-1R, GCGR
Indications under research or approved
MASH, Obesity
Regulatory status (reference entry)
Investigational (Phase 2)
Half-life
~6–8 days
Sequence
HSQGTFTSDYSKYLDEKAAKEFIEWLLEGGPSSGAPPPS
Sequence notes
Dual GLP-1 / glucagon agonist on Hanmi's LAPSCOVERY half-life extension platform (PEGylated Fc-like carrier).
Molecular weight (Da)
60000
Originator / sponsor
Merck (license from Hanmi)
First reported
2018

Primary References

Explore research articles about Efinopegdutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.