Exenatide Research: What 5,163 Studies Show (2026) | RetatrutideCompare

Exenatide — 5,163 studies indexed on PubMed. GLP-1 receptor agonist resistant to DPP-4 cleavage thanks to Gly substitution at position 2. Half-life: ~2.4 hours (Byetta) / ~2 weeks (Bydureon LAR microsphere). FDA status: FDA-approved (Byetta 2005, Bydureon 2012).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Exenatide?

There are approximately 5,163 studies indexed on PubMed that mention Exenatide (Byetta, Bydureon), based on a search last updated 2026-06-18.

Is Exenatide FDA-approved?

FDA status: FDA-approved (Byetta 2005, Bydureon 2012).

How does Exenatide work?

GLP-1 receptor agonist resistant to DPP-4 cleavage thanks to Gly substitution at position 2.

GLP-1 receptor agonist resistant to DPP-4 cleavage thanks to Gly substitution at position 2.

Reference facts

Also known as
Byetta, Bydureon, Exendin-4
Category
GLP-1 & Metabolic
Mechanism of action
GLP-1 receptor agonist resistant to DPP-4 cleavage thanks to Gly substitution at position 2.
Targets
GLP-1R
Indications under research or approved
Type 2 Diabetes
Regulatory status (reference entry)
FDA-approved (Byetta 2005, Bydureon 2012)
Half-life
~2.4 hours (Byetta) / ~2 weeks (Bydureon LAR microsphere)
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Sequence notes
39-residue peptide derived from exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum).
Molecular weight (Da)
4187
PDB accession
1JRJ
Originator / sponsor
Amylin / AstraZeneca
First reported
1992
Origin
Discovered by John Eng in Gila monster venom; first peptide isolated from a non-mammalian source to become an FDA-approved drug.

Primary References

Explore research articles about Exenatide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.