FOXO4-DRI Research: What 17 Studies Show (2026) | RetatrutideCompare

FOXO4-DRI — 17 studies indexed on PubMed. Disrupts the FOXO4-p53 interaction in senescent cells, freeing p53 to trigger intrinsic apoptosis selectively in senescent cells (senolytic). Half-life: Hours (DRI form resists proteolysis). FDA status: Preclinical / research only.

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on FOXO4-DRI?

There are approximately 17 studies indexed on PubMed that mention FOXO4-DRI (FOXO4-D-Retro-Inverso, ProxofimTM (research)), based on a search last updated 2026-06-18.

Is FOXO4-DRI FDA-approved?

FDA status: Preclinical / research only.

How does FOXO4-DRI work?

Disrupts the FOXO4-p53 interaction in senescent cells, freeing p53 to trigger intrinsic apoptosis selectively in senescent cells (senolytic).

Disrupts the FOXO4-p53 interaction in senescent cells, freeing p53 to trigger intrinsic apoptosis selectively in senescent cells (senolytic).

Reference facts

Also known as
FOXO4-D-Retro-Inverso, ProxofimTM (research)
Category
Mitochondrial & Cellular Longevity
Mechanism of action
Disrupts the FOXO4-p53 interaction in senescent cells, freeing p53 to trigger intrinsic apoptosis selectively in senescent cells (senolytic).
Targets
FOXO4-p53 complex
Indications under research or approved
Research — senescent cell clearance, age-related disease
Regulatory status (reference entry)
Preclinical / research only
Half-life
Hours (DRI form resists proteolysis)
Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Sequence notes
D-retro-inverso (DRI) peptide derived from the FOXO4 / p53 interaction interface, fused to a HIV-Tat-derived cell-penetrating sequence.
Molecular weight (Da)
5305
First reported
2017
Origin
Designed by de Keizer lab; published in Cell 2017.

Primary References

Explore research articles about FOXO4-DRI

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.