Liraglutide Research: What 5,740 Studies Show (2026) | RetatrutideCompare

Liraglutide — 5,740 studies indexed on PubMed. Once-daily GLP-1 receptor agonist. Albumin binding via fatty acid extends in-vivo half-life. Half-life: ~13 hours. FDA status: FDA-approved (Victoza 2010, Saxenda 2014).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Liraglutide?

There are approximately 5,740 studies indexed on PubMed that mention Liraglutide (Victoza, Saxenda), based on a search last updated 2026-06-18.

Is Liraglutide FDA-approved?

FDA status: FDA-approved (Victoza 2010, Saxenda 2014).

How does Liraglutide work?

Once-daily GLP-1 receptor agonist. Albumin binding via fatty acid extends in-vivo half-life.

Once-daily GLP-1 receptor agonist. Albumin binding via fatty acid extends in-vivo half-life.

Reference facts

Also known as
Victoza, Saxenda
Category
GLP-1 & Metabolic
Mechanism of action
Once-daily GLP-1 receptor agonist. Albumin binding via fatty acid extends in-vivo half-life.
Targets
GLP-1R
Indications under research or approved
Type 2 Diabetes (Victoza), Chronic Weight Management (Saxenda)
Regulatory status (reference entry)
FDA-approved (Victoza 2010, Saxenda 2014)
Half-life
~13 hours
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Sequence notes
31-residue GLP-1(7-37) analog with Lys26 acylated by a γ-glutamyl-spaced C16 palmitic acid (mediates albumin binding).
Molecular weight (Da)
3751
PDB accession
4APD
Originator / sponsor
Novo Nordisk
First reported
2000
Origin
First once-daily GLP-1 analog, scaffold for the entire fatty-acid acylation strategy used by Semaglutide and Tirzepatide.

Primary References

Explore research articles about Liraglutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.