Lixisenatide Research: What 738 Studies Show (2026) | RetatrutideCompare

Lixisenatide — 738 studies indexed on PubMed. Short-acting GLP-1 receptor agonist with strong post-prandial glucose effect. Half-life: ~3 hours. FDA status: FDA-approved (2016, US discontinued 2023).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Lixisenatide?

There are approximately 738 studies indexed on PubMed that mention Lixisenatide (Adlyxin, Lyxumia), based on a search last updated 2026-06-18.

Is Lixisenatide FDA-approved?

FDA status: FDA-approved (2016, US discontinued 2023).

How does Lixisenatide work?

Short-acting GLP-1 receptor agonist with strong post-prandial glucose effect.

Short-acting GLP-1 receptor agonist with strong post-prandial glucose effect.

Reference facts

Also known as
Adlyxin, Lyxumia
Category
GLP-1 & Metabolic
Mechanism of action
Short-acting GLP-1 receptor agonist with strong post-prandial glucose effect.
Targets
GLP-1R
Indications under research or approved
Type 2 Diabetes
Regulatory status (reference entry)
FDA-approved (2016, US discontinued 2023)
Half-life
~3 hours
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Sequence notes
Exendin-4 analog with C-terminal six-lysine tail and Pro38 deletion.
Molecular weight (Da)
4858
Originator / sponsor
Sanofi
First reported
2007

Primary References

Explore research articles about Lixisenatide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.