LL-37 Research: What 4,309 Studies Show (2026) | RetatrutideCompare

LL-37 — 4,309 studies indexed on PubMed. Cationic alpha-helix that disrupts microbial membranes and modulates innate immunity (chemotaxis, angiogenesis, wound healing). Half-life: Minutes (rapidly degraded). FDA status: Not FDA-approved.

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on LL-37?

There are approximately 4,309 studies indexed on PubMed that mention LL-37 (Cathelicidin, hCAP18 (37 aa fragment)), based on a search last updated 2026-06-18.

Is LL-37 FDA-approved?

FDA status: Not FDA-approved.

How does LL-37 work?

Cationic alpha-helix that disrupts microbial membranes and modulates innate immunity (chemotaxis, angiogenesis, wound healing).

Cationic alpha-helix that disrupts microbial membranes and modulates innate immunity (chemotaxis, angiogenesis, wound healing).

Reference facts

Also known as
Cathelicidin, hCAP18 (37 aa fragment)
Category
Immune Modulator
Mechanism of action
Cationic alpha-helix that disrupts microbial membranes and modulates innate immunity (chemotaxis, angiogenesis, wound healing).
Targets
Microbial membranes, FPR2/ALX receptor
Indications under research or approved
Research — antibiotic-resistant infections, wound healing, vitamin D innate immunity
Regulatory status (reference entry)
Not FDA-approved
Half-life
Minutes (rapidly degraded)
Sequence
[LL-37, 37 aa]
Sequence notes
37-residue active fragment of human cathelicidin antimicrobial peptide hCAP18; cleaved from the proform by proteinase 3.
Molecular weight (Da)
4493
PDB accession
2K6O
First reported
1995

Primary References

Explore research articles about LL-37

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.