LL-37 (Antimicrobial) Research: What 3,854 Studies Show (2026) | RetatrutideCompare

LL-37 (Antimicrobial) — 3,854 studies indexed on PubMed. Cationic membrane-disrupting helix with broad-spectrum activity against Gram-positive, Gram-negative bacteria, fungi, viruses. Half-life: Minutes. FDA status: Not FDA-approved.

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on LL-37 (Antimicrobial)?

There are approximately 3,854 studies indexed on PubMed that mention LL-37 (Antimicrobial) (Cathelicidin antimicrobial activity), based on a search last updated 2026-06-18.

Is LL-37 (Antimicrobial) FDA-approved?

FDA status: Not FDA-approved.

How does LL-37 (Antimicrobial) work?

Cationic membrane-disrupting helix with broad-spectrum activity against Gram-positive, Gram-negative bacteria, fungi, viruses.

Reference facts

Also known as: Cathelicidin antimicrobial activity
Category: Antimicrobial
Mechanism of action: Cationic membrane-disrupting helix with broad-spectrum activity against Gram-positive, Gram-negative bacteria, fungi, viruses.
Targets: Microbial membranes
Indications under research or approved: Research
Regulatory status (reference entry): Not FDA-approved
Half-life: Minutes
Sequence: [LL-37, 37 aa]
Sequence notes: Same molecule as the immune entry; listed separately for indexing under antimicrobial peptides.
Molecular weight (Da): 4493
PDB accession: 2K6O
First reported: 1995

Primary References

Vandamme et al., Cell Mol Immunol 2012

Explore research articles about LL-37 (Antimicrobial)

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.