Mazdutide Research: What 44 Studies Show (2026) | RetatrutideCompare

Mazdutide — 44 studies indexed on PubMed. Dual GLP-1 / glucagon receptor agonist licensed from Eli Lilly's OXM3 program. Half-life: ~140 hours (~6 days). FDA status: Approved in China (2025); Phase 3 in other regions.

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Mazdutide?

There are approximately 44 studies indexed on PubMed that mention Mazdutide (IBI362, OXM3), based on a search last updated 2026-06-18.

Is Mazdutide FDA-approved?

FDA status: Approved in China (2025); Phase 3 in other regions.

How does Mazdutide work?

Dual GLP-1 / glucagon receptor agonist licensed from Eli Lilly's OXM3 program.

Dual GLP-1 / glucagon receptor agonist licensed from Eli Lilly's OXM3 program.

Reference facts

Also known as
IBI362, OXM3
Category
GLP-1 & Metabolic
Mechanism of action
Dual GLP-1 / glucagon receptor agonist licensed from Eli Lilly's OXM3 program.
Targets
GLP-1R, GCGR
Indications under research or approved
Obesity, Type 2 Diabetes, MASH
Regulatory status (reference entry)
Approved in China (2025); Phase 3 in other regions
Half-life
~140 hours (~6 days)
Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Sequence notes
Oxyntomodulin analog with dual GLP-1 / glucagon activity; C18 fatty acid linker.
Molecular weight (Da)
4400
Originator / sponsor
Innovent Biologics (China license from Eli Lilly)
First reported
2020

Primary References

Explore research articles about Mazdutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.