Oxyntomodulin Research: What 514 Studies Show (2026) | RetatrutideCompare

Oxyntomodulin — 514 studies indexed on PubMed. Native dual incretin/glucagon hormone — template for synthetic dual agonists like Cotadutide and Mazdutide. Half-life: ~12 minutes. FDA status: Investigational.

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Oxyntomodulin?

There are approximately 514 studies indexed on PubMed that mention Oxyntomodulin (OXM), based on a search last updated 2026-06-18.

Is Oxyntomodulin FDA-approved?

FDA status: Investigational.

How does Oxyntomodulin work?

Native dual incretin/glucagon hormone — template for synthetic dual agonists like Cotadutide and Mazdutide.

Native dual incretin/glucagon hormone — template for synthetic dual agonists like Cotadutide and Mazdutide.

Reference facts

Also known as
OXM
Category
GLP-1 & Metabolic
Mechanism of action
Native dual incretin/glucagon hormone — template for synthetic dual agonists like Cotadutide and Mazdutide.
Targets
GLP-1R, GCGR
Indications under research or approved
Obesity (research)
Regulatory status (reference entry)
Investigational
Half-life
~12 minutes
Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Sequence notes
37-residue native dual GLP-1 / glucagon receptor agonist; proglucagon-derived gut hormone.
Molecular weight (Da)
4448
First reported
1983

Primary References

Explore research articles about Oxyntomodulin

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.