Pemvidutide Research: What 15 Studies Show (2026) | RetatrutideCompare

Pemvidutide — 15 studies indexed on PubMed. Balanced 1:1 GLP-1 / glucagon agonism designed to combine satiety with hepatic lipid burning. Half-life: ~6 days. FDA status: Investigational (Phase 2).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Pemvidutide?

There are approximately 15 studies indexed on PubMed that mention Pemvidutide (ALT-801), based on a search last updated 2026-06-18.

Is Pemvidutide FDA-approved?

FDA status: Investigational (Phase 2).

How does Pemvidutide work?

Balanced 1:1 GLP-1 / glucagon agonism designed to combine satiety with hepatic lipid burning.

Reference facts

Also known as: ALT-801
Category: GLP-1 & Metabolic
Mechanism of action: Balanced 1:1 GLP-1 / glucagon agonism designed to combine satiety with hepatic lipid burning.
Targets: GLP-1R, GCGR
Indications under research or approved: Obesity, MASH
Regulatory status (reference entry): Investigational (Phase 2)
Half-life: ~6 days
Sequence: HSQGTFTSDYSKYLDEKAAKEFVNWLLAGGPSSGAPPPS
Sequence notes: Dual GLP-1 / glucagon receptor agonist with proprietary C18 lipid moiety (EuPort technology).
Molecular weight (Da): 4500
Originator / sponsor: Altimmune
First reported: 2021

Primary References

MOMENTUM Phase 2 (Pemvidutide obesity)

Explore research articles about Pemvidutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.