PYY 3-36 Research: What 3,863 Studies Show (2026) | RetatrutideCompare

PYY 3-36 — 3,863 studies indexed on PubMed. Selective Y2 receptor agonist in the arcuate nucleus, suppressing appetite via NPY neuron inhibition. Half-life: ~10 minutes (native); analogs extend to days. FDA status: Investigational.

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on PYY 3-36?

There are approximately 3,863 studies indexed on PubMed that mention PYY 3-36 (Peptide YY (3-36)), based on a search last updated 2026-06-18.

Is PYY 3-36 FDA-approved?

FDA status: Investigational.

How does PYY 3-36 work?

Selective Y2 receptor agonist in the arcuate nucleus, suppressing appetite via NPY neuron inhibition.

Selective Y2 receptor agonist in the arcuate nucleus, suppressing appetite via NPY neuron inhibition.

Reference facts

Also known as
Peptide YY (3-36)
Category
GLP-1 & Metabolic
Mechanism of action
Selective Y2 receptor agonist in the arcuate nucleus, suppressing appetite via NPY neuron inhibition.
Targets
Y2 receptor
Indications under research or approved
Obesity (research; native peptide and long-acting analogs)
Regulatory status (reference entry)
Investigational
Half-life
~10 minutes (native); analogs extend to days
Sequence
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Sequence notes
34-residue gut-derived satiety peptide; a DPP-4 cleavage product of PYY 1-36.
Molecular weight (Da)
4050
PDB accession
2DEZ
Originator / sponsor
Novo Nordisk and others (analogs)
First reported
1982

Primary References

Explore research articles about PYY 3-36

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.