Retatrutide Research: What 154 Studies Show (2026) | RetatrutideCompare

Retatrutide — 154 studies indexed on PubMed. Triple agonist of GLP-1, GIP and glucagon receptors. Glucagon arm increases energy expenditure on top of incretin-driven satiety and insulinotropic effects. Half-life: ~124 hours (~5–6 days). FDA status: Investigational (Phase 3 — TRIUMPH program).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Retatrutide?

There are approximately 154 studies indexed on PubMed that mention Retatrutide (LY3437943), based on a search last updated 2026-06-18.

Is Retatrutide FDA-approved?

FDA status: Investigational (Phase 3 — TRIUMPH program).

How does Retatrutide work?

Triple agonist of GLP-1, GIP and glucagon receptors. Glucagon arm increases energy expenditure on top of incretin-driven satiety and insulinotropic effects.

Triple agonist of GLP-1, GIP and glucagon receptors. Glucagon arm increases energy expenditure on top of incretin-driven satiety and insulinotropic effects.

Reference facts

Also known as
LY3437943
Category
GLP-1 & Metabolic
Mechanism of action
Triple agonist of GLP-1, GIP and glucagon receptors. Glucagon arm increases energy expenditure on top of incretin-driven satiety and insulinotropic effects.
Targets
GLP-1R, GIPR, GCGR
Indications under research or approved
Obesity, Type 2 Diabetes, MASH
Regulatory status (reference entry)
Investigational (Phase 3 — TRIUMPH program)
Half-life
~124 hours (~5–6 days)
Sequence
YXEGTFTSDYSIYLDKKAQEAFVNWLLAGGPSSGAPPPS
Sequence notes
Triple agonist (GLP-1 / GIP / glucagon) with two C20 fatty diacid linkers and Aib substitutions at positions 2 and 13 (X = α-Aminoisobutyric acid). Representative backbone shown.
Molecular weight (Da)
4731
Originator / sponsor
Eli Lilly
First reported
2022
Origin
Disclosed at the 2022 ADA Scientific Sessions; first-in-human data published NEJM 2023.

Primary References

Explore research articles about Retatrutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.