Survodutide Research: What 72 Studies Show (2026) | RetatrutideCompare

Survodutide — 72 studies indexed on PubMed. Dual GLP-1 / glucagon receptor agonist. Glucagon arm drives hepatic lipid mobilization and energy expenditure. Half-life: ~5 days. FDA status: Investigational (Phase 3 SYNCHRONIZE; FDA Breakthrough Therapy for MASH 2024).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Survodutide?

There are approximately 72 studies indexed on PubMed that mention Survodutide (BI 456906), based on a search last updated 2026-06-18.

Is Survodutide FDA-approved?

FDA status: Investigational (Phase 3 SYNCHRONIZE; FDA Breakthrough Therapy for MASH 2024).

How does Survodutide work?

Dual GLP-1 / glucagon receptor agonist. Glucagon arm drives hepatic lipid mobilization and energy expenditure.

Reference facts

Also known as: BI 456906
Category: GLP-1 & Metabolic
Mechanism of action: Dual GLP-1 / glucagon receptor agonist. Glucagon arm drives hepatic lipid mobilization and energy expenditure.
Targets: GLP-1R, GCGR
Indications under research or approved: Obesity, MASH
Regulatory status (reference entry): Investigational (Phase 3 SYNCHRONIZE; FDA Breakthrough Therapy for MASH 2024)
Half-life: ~5 days
Sequence: HSQGTFTSDYSKYLDEKAAKEFIEWLLEGGPSSGAPPPS
Sequence notes: Dual GLP-1 / glucagon receptor agonist with C18 fatty acid moiety and Aib stabilization.
Molecular weight (Da): 4500
Originator / sponsor: Boehringer Ringer / Zealand Pharma
First reported: 2022

Primary References

Explore research articles about Survodutide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.