Teriparatide Research: What 5,122 Studies Show (2026) | RetatrutideCompare

Teriparatide — 5,122 studies indexed on PubMed. Intermittent PTH receptor activation paradoxically stimulates osteoblastic bone formation more than osteoclastic resorption. Half-life: ~1 hour. FDA status: FDA-approved (2002).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Teriparatide?

There are approximately 5,122 studies indexed on PubMed that mention Teriparatide (Forteo, PTH 1-34), based on a search last updated 2026-06-18.

Is Teriparatide FDA-approved?

FDA status: FDA-approved (2002).

How does Teriparatide work?

Intermittent PTH receptor activation paradoxically stimulates osteoblastic bone formation more than osteoclastic resorption.

Reference facts

Also known as: Forteo, PTH 1-34, rhPTH(1-34)
Category: Bone & Calcium
Mechanism of action: Intermittent PTH receptor activation paradoxically stimulates osteoblastic bone formation more than osteoclastic resorption.
Targets: PTH1R
Indications under research or approved: Severe osteoporosis (post-menopausal women, men, glucocorticoid-induced)
Regulatory status (reference entry): FDA-approved (2002)
Half-life: ~1 hour
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence notes: 34-residue N-terminal active fragment of human parathyroid hormone, recombinant.
Molecular weight (Da): 4118
PDB accession: 1ET1
Originator / sponsor: Eli Lilly
First reported: 1995

Primary References

Neer et al., NEJM 2001 (Forteo pivotal)

Explore research articles about Teriparatide

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.