Tesamorelin Research: What 122 Studies Show (2026) | RetatrutideCompare

Tesamorelin — 122 studies indexed on PubMed. Stabilized full-length GHRH analog. Lipid modification protects against DPP-4 cleavage. Half-life: ~26 minutes (subcutaneous). FDA status: FDA-approved (2010).

PubMed search-result count last fetched 2026-06-18. Records may include reviews, laboratory work, and animal studies; this is not a clinical trial count or a measure of efficacy.

Inspect the PubMed query and results

How many studies have been published on Tesamorelin?

There are approximately 122 studies indexed on PubMed that mention Tesamorelin (Egrifta, TH9507), based on a search last updated 2026-06-18.

Is Tesamorelin FDA-approved?

FDA status: FDA-approved (2010).

How does Tesamorelin work?

Stabilized full-length GHRH analog. Lipid modification protects against DPP-4 cleavage.

Stabilized full-length GHRH analog. Lipid modification protects against DPP-4 cleavage.

Reference facts

Also known as
Egrifta, TH9507
Category
Growth Hormone & Ghrelin
Mechanism of action
Stabilized full-length GHRH analog. Lipid modification protects against DPP-4 cleavage.
Targets
GHRHR
Indications under research or approved
HIV-associated lipodystrophy (visceral adipose reduction)
Regulatory status (reference entry)
FDA-approved (2010)
Half-life
~26 minutes (subcutaneous)
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Sequence notes
44-residue full-length human GHRH (1-44) NH2 with a trans-3-hexenoyl group attached to the N-terminal tyrosine.
Molecular weight (Da)
5135
Originator / sponsor
Theratechnologies
First reported
2007

Primary References

Explore research articles about Tesamorelin

This is an educational reference, not medical advice. Research findings do not establish safety or efficacy for self-administration. Consult the primary sources for study populations, limitations, and current regulatory status.